PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G052300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 364aa    MW: 39176.3 Da    PI: 4.7197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G052300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-184693148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT eEd+llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Sevir.3G052300.1.p 46 RGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 93
                        89********************************************97 PP

2Myb_DNA-binding52.61e-1699142146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sevir.3G052300.1.p  99 RGNITAEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 142
                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.214193IPR017930Myb domain
SuperFamilySSF466896.36E-3144140IPR009057Homeodomain-like
SMARTSM007171.1E-154595IPR001005SANT/Myb domain
PfamPF002497.2E-174693IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-2347100IPR009057Homeodomain-like
CDDcd001672.50E-124893No hitNo description
PROSITE profilePS5129423.79394148IPR017930Myb domain
SMARTSM007173.3E-1598146IPR001005SANT/Myb domain
PfamPF002492.4E-1599142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-23101147IPR009057Homeodomain-like
CDDcd001673.91E-12103142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MDMDMDMDMG MCGLDELEVL AMSPGGSAAS AAAAPVASED EGDLRRGPWT VEEDLLLVNY  60
IAAHGEGRWN SLARSAGLKR TGKSCRLRWL NYLRPDVRRG NITAEEQLLI LELHSRWGNR  120
WSKIAQHLPG RTDNEIKNYW RTRVQKHAKQ LRCDVNSRQF RDVVRHVWMP RLVERIQAEY  180
SGGSAVVAQA PAAPAALVAP ATTTASAPAA YYHPSPYGGH GQSADGVVPP SKAHGGGYYH  240
ADYYSYSEPG QEPAPAAMSP DDTSSALRSS LTDATSHGAQ HHYAASAATP TNEGFCGAAE  300
PTAAGGDDVV QEEEEDVFAG TWSELLAAAG SDGGSKIGLP DFEFADFEDN LWSLEDLCLQ  360
QLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-26431461103MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-26441462103C-Myb DNA-Binding Domain
1mse_C1e-26441462103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794341e-140HF679434.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB28 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700181.10.0PREDICTED: transcriptional activator Myb
TrEMBLK3Z7F40.0K3Z7F4_SETIT; Uncharacterized protein
STRINGSi022474m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-83myb domain protein 112